representative clinical mrsa visa strain mu50 Search Results


99
ATCC representative clinical mrsa visa strain mu50
A Schematic overview of the CPPT setup for comparative analysis of VISA strain <t>Mu50</t> and a VSSA control. Cells were labelled with Vancomycin-BFL and PI. PI (+) -cells are depicted in gray, PI (–) -cells with different degrees of Vanco-BFL-labeling are indicated in light and dark green. PI (–) -cells were sorted onto Mueller-Hinton Agar (MHA) supplemented with different concentrations of vancomycin and colony formation was observed at different time points and for individual plates by time-lapse imaging. For VISA cells growth on a 0.25× MIC plate was used for cell fate determination (regular colony, delayed, smaller colony or no colony) prior to phenotypic backtracing of the ancestral phenotypic signatures in the flow cytometry dot plot. The exemplary dot plot shows all recorded Vanco-BFL ( +) , PI (–) events in light green, Vanco-BFL (+) , PI (+) -events in grey. The individually colored dots correspond to backtraced, sorted cells that were determined to belong the ´regular colony´ cell fate category. B Flow cytometry histogram showing the fluorescence signal in the Vanco-BFL-A channel of unstained and Vanco-BFL-labelled VSSA (blue) and VISA cells (red)´. C Percentage of sorted events that gave rise to colonies on agar plates with different concentrations of vancomycin. D Violin plot showing the cellular Vanco-BFL signal intensity of VISA cells for the different cell fate groups determined after growth on 0.25xMIC vancomycin. The graph shows the results of N = 960 sorted events from a single pre-sorting culture and is representative for 4 biological replicates. Statistical significance testing was performed by Kruskal–Wallis test in combination with Dunn´s multiple comparisons test. E Colony growth dynamics of sorted VISA cells in the presence (0.25xMIC) and absence of vancomycin as analyzed by time-lapse imaging analysis (compare Supplementary Movies , ). Growth ( Y -axis) was measured as contour size on the edge of the colony and is plotted against cultivation time. Raw data and calculations are available in Supplementary Data . The figure was created with BioRender.
Representative Clinical Mrsa Visa Strain Mu50, supplied by ATCC, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/representative clinical mrsa visa strain mu50/product/ATCC
Average 99 stars, based on 1 article reviews
representative clinical mrsa visa strain mu50 - by Bioz Stars, 2026-03
99/100 stars
  Buy from Supplier

99
ATCC mrsa strains
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
Mrsa Strains, supplied by ATCC, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mrsa strains/product/ATCC
Average 99 stars, based on 1 article reviews
mrsa strains - by Bioz Stars, 2026-03
99/100 stars
  Buy from Supplier

90
Microbiologics Inc mu50 atcc700699
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
Mu50 Atcc700699, supplied by Microbiologics Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mu50 atcc700699/product/Microbiologics Inc
Average 90 stars, based on 1 article reviews
mu50 atcc700699 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Biotechnology Information orfs annotated in strains n315 and mu50
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
Orfs Annotated In Strains N315 And Mu50, supplied by Biotechnology Information, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/orfs annotated in strains n315 and mu50/product/Biotechnology Information
Average 90 stars, based on 1 article reviews
orfs annotated in strains n315 and mu50 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
LGC Promochem mu50
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
Mu50, supplied by LGC Promochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mu50/product/LGC Promochem
Average 90 stars, based on 1 article reviews
mu50 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
SAS institute s. aureus alanine racemase from the mu50 strain
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
S. Aureus Alanine Racemase From The Mu50 Strain, supplied by SAS institute, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/s. aureus alanine racemase from the mu50 strain/product/SAS institute
Average 90 stars, based on 1 article reviews
s. aureus alanine racemase from the mu50 strain - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Cedarlane s. aureus mu50 genome
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
S. Aureus Mu50 Genome, supplied by Cedarlane, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/s. aureus mu50 genome/product/Cedarlane
Average 90 stars, based on 1 article reviews
s. aureus mu50 genome - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Cedarlane genomes of bacillus subtilis strain 168
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
Genomes Of Bacillus Subtilis Strain 168, supplied by Cedarlane, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/genomes of bacillus subtilis strain 168/product/Cedarlane
Average 90 stars, based on 1 article reviews
genomes of bacillus subtilis strain 168 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Achillion inc s. aureus strain mu50
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
S. Aureus Strain Mu50, supplied by Achillion inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/s. aureus strain mu50/product/Achillion inc
Average 90 stars, based on 1 article reviews
s. aureus strain mu50 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

93
ATCC medium 2107
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
Medium 2107, supplied by ATCC, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/medium 2107/product/ATCC
Average 93 stars, based on 1 article reviews
medium 2107 - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

96
ATCC s aureus col
Susceptibility of <t> MRSA strains </t> to <t> SNH </t> and eight antibiotics.
S Aureus Col, supplied by ATCC, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/s aureus col/product/ATCC
Average 96 stars, based on 1 article reviews
s aureus col - by Bioz Stars, 2026-03
96/100 stars
  Buy from Supplier

90
Millipore pet-28b(+) vector
Macromolecule-production information (Nakamura et al. , 2006 ▸ , 2010 ▸ )
Pet 28b(+) Vector, supplied by Millipore, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pet-28b(+) vector/product/Millipore
Average 90 stars, based on 1 article reviews
pet-28b(+) vector - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

Image Search Results


A Schematic overview of the CPPT setup for comparative analysis of VISA strain Mu50 and a VSSA control. Cells were labelled with Vancomycin-BFL and PI. PI (+) -cells are depicted in gray, PI (–) -cells with different degrees of Vanco-BFL-labeling are indicated in light and dark green. PI (–) -cells were sorted onto Mueller-Hinton Agar (MHA) supplemented with different concentrations of vancomycin and colony formation was observed at different time points and for individual plates by time-lapse imaging. For VISA cells growth on a 0.25× MIC plate was used for cell fate determination (regular colony, delayed, smaller colony or no colony) prior to phenotypic backtracing of the ancestral phenotypic signatures in the flow cytometry dot plot. The exemplary dot plot shows all recorded Vanco-BFL ( +) , PI (–) events in light green, Vanco-BFL (+) , PI (+) -events in grey. The individually colored dots correspond to backtraced, sorted cells that were determined to belong the ´regular colony´ cell fate category. B Flow cytometry histogram showing the fluorescence signal in the Vanco-BFL-A channel of unstained and Vanco-BFL-labelled VSSA (blue) and VISA cells (red)´. C Percentage of sorted events that gave rise to colonies on agar plates with different concentrations of vancomycin. D Violin plot showing the cellular Vanco-BFL signal intensity of VISA cells for the different cell fate groups determined after growth on 0.25xMIC vancomycin. The graph shows the results of N = 960 sorted events from a single pre-sorting culture and is representative for 4 biological replicates. Statistical significance testing was performed by Kruskal–Wallis test in combination with Dunn´s multiple comparisons test. E Colony growth dynamics of sorted VISA cells in the presence (0.25xMIC) and absence of vancomycin as analyzed by time-lapse imaging analysis (compare Supplementary Movies , ). Growth ( Y -axis) was measured as contour size on the edge of the colony and is plotted against cultivation time. Raw data and calculations are available in Supplementary Data . The figure was created with BioRender.

Journal: Communications Biology

Article Title: Single-cell phenotypic profiling and backtracing exposes and predicts clinically relevant subpopulations in isogenic Staphylococcus aureus communities

doi: 10.1038/s42003-024-06894-z

Figure Lengend Snippet: A Schematic overview of the CPPT setup for comparative analysis of VISA strain Mu50 and a VSSA control. Cells were labelled with Vancomycin-BFL and PI. PI (+) -cells are depicted in gray, PI (–) -cells with different degrees of Vanco-BFL-labeling are indicated in light and dark green. PI (–) -cells were sorted onto Mueller-Hinton Agar (MHA) supplemented with different concentrations of vancomycin and colony formation was observed at different time points and for individual plates by time-lapse imaging. For VISA cells growth on a 0.25× MIC plate was used for cell fate determination (regular colony, delayed, smaller colony or no colony) prior to phenotypic backtracing of the ancestral phenotypic signatures in the flow cytometry dot plot. The exemplary dot plot shows all recorded Vanco-BFL ( +) , PI (–) events in light green, Vanco-BFL (+) , PI (+) -events in grey. The individually colored dots correspond to backtraced, sorted cells that were determined to belong the ´regular colony´ cell fate category. B Flow cytometry histogram showing the fluorescence signal in the Vanco-BFL-A channel of unstained and Vanco-BFL-labelled VSSA (blue) and VISA cells (red)´. C Percentage of sorted events that gave rise to colonies on agar plates with different concentrations of vancomycin. D Violin plot showing the cellular Vanco-BFL signal intensity of VISA cells for the different cell fate groups determined after growth on 0.25xMIC vancomycin. The graph shows the results of N = 960 sorted events from a single pre-sorting culture and is representative for 4 biological replicates. Statistical significance testing was performed by Kruskal–Wallis test in combination with Dunn´s multiple comparisons test. E Colony growth dynamics of sorted VISA cells in the presence (0.25xMIC) and absence of vancomycin as analyzed by time-lapse imaging analysis (compare Supplementary Movies , ). Growth ( Y -axis) was measured as contour size on the edge of the colony and is plotted against cultivation time. Raw data and calculations are available in Supplementary Data . The figure was created with BioRender.

Article Snippet: Single colonies (3 biological replicates) of the vancomycin susceptible S. aureus strain ATCC 29213 and representative clinical MRSA-VISA strain Mu50 (ATCC 700699) were grown overnight in TSB at 37 °C.

Techniques: Control, Labeling, Imaging, Flow Cytometry, Fluorescence

Bacterial strains used in this study

Journal: Communications Biology

Article Title: Single-cell phenotypic profiling and backtracing exposes and predicts clinically relevant subpopulations in isogenic Staphylococcus aureus communities

doi: 10.1038/s42003-024-06894-z

Figure Lengend Snippet: Bacterial strains used in this study

Article Snippet: Single colonies (3 biological replicates) of the vancomycin susceptible S. aureus strain ATCC 29213 and representative clinical MRSA-VISA strain Mu50 (ATCC 700699) were grown overnight in TSB at 37 °C.

Techniques: Isolation, Plasmid Preparation

Susceptibility of  MRSA strains  to  SNH  and eight antibiotics.

Journal: PLoS ONE

Article Title: In Vitro Activity of Sodium New Houttuyfonate Alone and in Combination with Oxacillin or Netilmicin against Methicillin-Resistant Staphylococcus aureus

doi: 10.1371/journal.pone.0068053

Figure Lengend Snippet: Susceptibility of MRSA strains to SNH and eight antibiotics.

Article Snippet: Kill kinetics of SNH was determined by time-kill experiments for five MRSA strains (three clinical isolates MRSA 5–20, MRSA 6–29 and MRSA 8–36 and two reference strains ATCC 33591 and Mu50) according to the method described by Verma et al. with slight modifications .

Techniques:

Effects of  SNH  in combination with antibiotics against 12  MRSA strains  in checkerboard assay.

Journal: PLoS ONE

Article Title: In Vitro Activity of Sodium New Houttuyfonate Alone and in Combination with Oxacillin or Netilmicin against Methicillin-Resistant Staphylococcus aureus

doi: 10.1371/journal.pone.0068053

Figure Lengend Snippet: Effects of SNH in combination with antibiotics against 12 MRSA strains in checkerboard assay.

Article Snippet: Kill kinetics of SNH was determined by time-kill experiments for five MRSA strains (three clinical isolates MRSA 5–20, MRSA 6–29 and MRSA 8–36 and two reference strains ATCC 33591 and Mu50) according to the method described by Verma et al. with slight modifications .

Techniques:

A) MRSA 5–20, 1/2×MIC SNH-1/64×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 128 µg/mL); B) MRSA 6–29, 1/2×MIC SNH-1/64×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 256 µg/mL); C) MRSA 8–36, 1/2×MIC SNH-1/128×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 512 µg/mL); D) ATCC 33591 1/2×MIC SNH-1/64×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 256 µg/mL); E) Mu 50, 1/2×MIC SNH-1/128×MIC OXA (MIC of SNH = 64 µg/mL, MIC of OXA = 512 µg/mL); ▪, GC, growth control; ▴, SNH; ◊, OXA; ○, combination of SNH and OXA.

Journal: PLoS ONE

Article Title: In Vitro Activity of Sodium New Houttuyfonate Alone and in Combination with Oxacillin or Netilmicin against Methicillin-Resistant Staphylococcus aureus

doi: 10.1371/journal.pone.0068053

Figure Lengend Snippet: A) MRSA 5–20, 1/2×MIC SNH-1/64×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 128 µg/mL); B) MRSA 6–29, 1/2×MIC SNH-1/64×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 256 µg/mL); C) MRSA 8–36, 1/2×MIC SNH-1/128×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 512 µg/mL); D) ATCC 33591 1/2×MIC SNH-1/64×MIC OXA (MIC of SNH = 32 µg/mL, MIC of OXA = 256 µg/mL); E) Mu 50, 1/2×MIC SNH-1/128×MIC OXA (MIC of SNH = 64 µg/mL, MIC of OXA = 512 µg/mL); ▪, GC, growth control; ▴, SNH; ◊, OXA; ○, combination of SNH and OXA.

Article Snippet: Kill kinetics of SNH was determined by time-kill experiments for five MRSA strains (three clinical isolates MRSA 5–20, MRSA 6–29 and MRSA 8–36 and two reference strains ATCC 33591 and Mu50) according to the method described by Verma et al. with slight modifications .

Techniques: Control

A) MRSA 5–20, 1/2×MIC SNH-1/4×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 16 µg/mL); B) MRSA 6–29, 1/2×MIC SNH-1/2×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 8 µg/mL); C) MRSA 8–36, 1/2×MIC SNH-1/8×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 64 µg/mL); D) ATCC 33591 1/2×MIC SNH-1/4×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 4 µg/mL); E) Mu 50, 1/2×MIC SNH-1/4×MIC NET (MIC of SNH = 64 µg/mL, MIC of NET = 16 µg/mL); ▪, GC, growth control; ▴, SNH; ▽, NET; ○, combination of SNH and NET.

Journal: PLoS ONE

Article Title: In Vitro Activity of Sodium New Houttuyfonate Alone and in Combination with Oxacillin or Netilmicin against Methicillin-Resistant Staphylococcus aureus

doi: 10.1371/journal.pone.0068053

Figure Lengend Snippet: A) MRSA 5–20, 1/2×MIC SNH-1/4×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 16 µg/mL); B) MRSA 6–29, 1/2×MIC SNH-1/2×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 8 µg/mL); C) MRSA 8–36, 1/2×MIC SNH-1/8×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 64 µg/mL); D) ATCC 33591 1/2×MIC SNH-1/4×MIC NET (MIC of SNH = 32 µg/mL, MIC of NET = 4 µg/mL); E) Mu 50, 1/2×MIC SNH-1/4×MIC NET (MIC of SNH = 64 µg/mL, MIC of NET = 16 µg/mL); ▪, GC, growth control; ▴, SNH; ▽, NET; ○, combination of SNH and NET.

Article Snippet: Kill kinetics of SNH was determined by time-kill experiments for five MRSA strains (three clinical isolates MRSA 5–20, MRSA 6–29 and MRSA 8–36 and two reference strains ATCC 33591 and Mu50) according to the method described by Verma et al. with slight modifications .

Techniques: Control

Macromolecule-production information (Nakamura et al. , 2006 ▸ , 2010 ▸ )

Journal: Acta Crystallographica. Section F, Structural Biology Communications

Article Title: Neutron crystallographic study of heterotrimeric glutamine amidotransferase CAB

doi: 10.1107/S2053230X19000220

Figure Lengend Snippet: Macromolecule-production information (Nakamura et al. , 2006 ▸ , 2010 ▸ )

Article Snippet: Macromolecule-production information is given in Table 1 . table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Source organism S. aureus Mu50 Cloning site NcoI/XhoI Expression vector pET-28b(+) vector (Novagen) Expression host E. coli B834 strain Complete amino-acid sequence of the construct produced GatA MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLTMYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHDVYEKL GatB MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHHH GatC MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA Open in a separate window caption a8 Macromolecule-production information (Nakamura et al. , 2006 , 2010 ) 2.2.

Techniques: Clone Assay, Expressing, Plasmid Preparation, Sequencing, Construct, Produced